PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bradi1g11800.5.p
Common NameBRADI_1g11800, LOC100846874
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family NF-YA
Protein Properties Length: 263aa    MW: 28496.8 Da    PI: 9.9309
Description NF-YA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bradi1g11800.5.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1CBFB_NFYA102.63.7e-32168224158
         CBFB_NFYA   1 deplYVNaKQyqrIlkRRqkRakleeekkldeksrkpylheSRhkhAlrRpRgsgGrF 58 
                       +ep+YVNaKQy++Il+RRq+Rak+e e+k  +k+rkpylheSRh+hA+rR+Rg+gGrF
  Bradi1g11800.5.p 168 EEPVYVNAKQYHGILRRRQSRAKAELERKA-IKARKPYLHESRHQHAMRRARGTGGRF 224
                       69***************************9.**************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005219.1E-36166227IPR001289Nuclear transcription factor Y subunit A
PROSITE profilePS5115238.039167227IPR001289Nuclear transcription factor Y subunit A
PfamPF020452.2E-27169224IPR001289Nuclear transcription factor Y subunit A
PRINTSPR006167.7E-25170192IPR001289Nuclear transcription factor Y subunit A
PROSITE patternPS006860172192IPR018362CCAAT-binding factor, conserved site
PRINTSPR006167.7E-25201224IPR001289Nuclear transcription factor Y subunit A
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010262Biological Processsomatic embryogenesis
GO:0045892Biological Processnegative regulation of transcription, DNA-templated
GO:0055046Biological Processmicrogametogenesis
GO:0016602Cellular ComponentCCAAT-binding factor complex
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 263 aa     Download sequence    Send to blast
MSGMGSRPEG TNLVEPRGQG ALPSGMAMQP WWTGSGLGAV SPAVVAPGSG IGMSLSSNPV  60
GDGATKGKTS DDARADSSED SQRSGEPKDR SFGEEKHHAT SRMPALASDY LAPYSQLELN  120
QPIASATYPY PDAYYTGMVG PYGAQAVTHF QLPGLTQSRM PLPLEISEEP VYVNAKQYHG  180
ILRRRQSRAK AELERKAIKA RKPYLHESRH QHAMRRARGT GGRFLNTKKN ENGASKERAE  240
PNKGDQNSEY HRVPPDLQLR QA*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4awl_A1e-20168232266NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT ALPHA
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003560983.10.0PREDICTED: nuclear transcription factor Y subunit A-4-like
RefseqXP_010231280.10.0PREDICTED: nuclear transcription factor Y subunit A-4-like
RefseqXP_014752975.10.0PREDICTED: nuclear transcription factor Y subunit A-4-like
RefseqXP_014752976.10.0PREDICTED: nuclear transcription factor Y subunit A-4-like
TrEMBLI1GPC20.0I1GPC2_BRADI; Uncharacterized protein
STRINGBRADI1G11800.10.0(Brachypodium distachyon)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G20910.14e-43nuclear factor Y, subunit A9